Table 1

Summary of the epitope mapping of human islet-infiltrating CD4+ T-cell clones

Proinsulin
B-chainC-peptideA-chain
1510152025303540455055606570758085HLAaNo. of clones (clone names)
FVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN
                             VELGGGPGADQ84 (1.9, 2.1, 3.14, 4.6)
                             VELGGGPGADQ83 (5.8, 5.9, 6.15)
                             VELGGGPGADQ81 (2.13)
                            QVELGGGPGAGDQ81 (4.13)
                            QVELGGGPGDQ81 (5.5)
                                  AGSLQPLALEDQ81 (1.1)
                                  AGSLQPLALDQ81 (1.2)
                                   SLQPLALEGSLDQ8trans2 (2.4, 3.15)
  • Boldface indicates parts of a chain.

  • aDQ8 = HLA-DQA1*03:01; DQB1*03:02; DQ8trans = HLA-DQA1*05:01; DQB1*03:02.